PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_33.151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MYB
Protein Properties Length: 559aa    MW: 60609.5 Da    PI: 5.6674
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_33.151genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-183784148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  evm.model.supercontig_33.151 37 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 84
                                  79******************************************9986 PP

2Myb_DNA-binding52.51.1e-1690133146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   +g++++eE++l++++++++G++ W++ a++++ gRt++++k++w++
  evm.model.supercontig_33.151  90 KGAFSQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 133
                                   799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1133284IPR017930Myb domain
SMARTSM007177.0E-163686IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-3036131IPR009057Homeodomain-like
PfamPF002496.5E-163784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-243891IPR009057Homeodomain-like
CDDcd001675.31E-123984No hitNo description
PROSITE profilePS5129426.4385139IPR017930Myb domain
SMARTSM007174.7E-1789137IPR001005SANT/Myb domain
PfamPF002499.8E-1690133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2692138IPR009057Homeodomain-like
CDDcd001672.33E-1292133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MSHTTNESDE GILPKDQIFT DEGNSGGSAG GGIVLKKGPW TSAEDAILID YVKKHGEGNW  60
NAVQKHSGLS RCGKSCRLRW ANHLRPNLKK GAFSQEEEQL IIELHAKMGN KWARMAAHLP  120
GRTDNEIKNY WNTRIKRRQR AGLPLYPPEM CLQAFKESQQ GQNASGINSG DKGHHDLLQA  180
NSFEIPDVIF DSLKGSHSVL PYVPELPGMS NSSMLMKGFS SSQYCSFLPP STHRQKRIRE  240
STSLLAAYGD SVKDDFSSFN SFHDNIHQKV ARSFGLSFPH DPDPNAKTPD AFGVDQGGHT  300
LSNGNFSTSR PILEAMKLEL PSLQYPETDL GSWSRSCSPP ALLEPVDAFI QSPPRLGTDE  360
SDCVSPRNSG LLDALLHEAK NISSTKNHSH SSEKVCSSTI LADMGDSSTP PMCCDPKWGE  420
YGDPLSPLGH STTSLFSDCA PFSASGSSLD ESPPAEFTGC KLKSESVDLA WTPEGKEEPT  480
RFNITQPDIL LASDWLEQNS GHVKDPGMVS DALANLLGDD LGNEYKQMAA GGSSGQGWGL  540
GSCAWNNMPA VCQMTELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068750.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068751.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068752.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067L7W60.0A0A067L7W6_JATCU; MYB family protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-133myb domain protein 33